PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G08390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 195aa    MW: 21589.5 Da    PI: 8.2497
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G08390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.51e-191057249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     +i + + r v fskRr+ ++KKA+ELS+LC+++vav+++s+ gk y +
  LPERR08G08390.1 10 PILDARARDVCFSKRRQVVMKKANELSILCGVDVAVVVYSPAGKPYSF 57
                     6788999*************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.75161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-26160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-23176IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-16323IPR002100Transcription factor, MADS-box
PfamPF003197.4E-231157IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MRRGKVKIKP ILDARARDVC FSKRRQVVMK KANELSILCG VDVAVVVYSP AGKPYSFGSP  60
SSQAITHRLL GMAPSNPTMG DGSNGSGGET NILHELNLKY QQIQQENEVE NKKNKTSQQA  120
VNNEHGEHVR LDSDVNVLEL HELEAFDSKL NIIDEAVHLY HVVKNGKQAL EPQPEINMPT  180
TLQLTFNGQR IAPSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9X6F11e-144A0A0D9X6F1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA028419-PA2e-86(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2310166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.13e-22AGAMOUS-like 29